PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.052860.4
Common NameCsa_6G291920, LOC101212503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARF
Protein Properties Length: 636aa    MW: 71015.8 Da    PI: 8.4088
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.052860.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.72.1e-232103199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++p++ ae++       ++ +  s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + +
  Cucsa.052860.4   2 FCKTLTASDTSTHGGFSVPRRAAEDCfppldytQLRP--SQELIAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLISGDAVLFL--RGE 92 
                     99****************************9887775..458************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+++++r+
  Cucsa.052860.4  93 NGELRLGIRRA 103
                     9999****996 PP

2Auxin_resp122.23.9e-40128209182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +++a+stks+F+v+YnPra +++F+++++k++k+++++vsvG+Rfkm+fe++ds+err+ G+vvg+sd+d++rWpnSkWr+L
  Cucsa.052860.4 128 VVKAISTKSTFDVFYNPRAYHAQFIISCQKYVKSINNPVSVGTRFKMRFEMDDSPERRFNGVVVGISDMDSFRWPNSKWRCL 209
                     6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-371112IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.54E-421113IPR015300DNA-binding pseudobarrel domain
CDDcd100171.85E-221102No hitNo description
PfamPF023623.0E-212103IPR003340B3 DNA binding domain
SMARTSM010197.5E-242104IPR003340B3 DNA binding domain
PROSITE profilePS5086312.9152104IPR003340B3 DNA binding domain
PfamPF065075.7E-34129209IPR010525Auxin response factor
PROSITE profilePS5174520.062507591IPR000270PB1 domain
SuperFamilySSF542771.11E-8509586No hitNo description
PfamPF023092.4E-5554592IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MFCKTLTASD TSTHGGFSVP RRAAEDCFPP LDYTQLRPSQ ELIAKDLHGV EWRFRHIYRG  60
QPRRHLLTTG WSIFVSQKNL ISGDAVLFLR GENGELRLGI RRAVRPRNGL PDSIVGNQNS  120
CANDLARVVK AISTKSTFDV FYNPRAYHAQ FIISCQKYVK SINNPVSVGT RFKMRFEMDD  180
SPERRFNGVV VGISDMDSFR WPNSKWRCLT VRWDKDSDHQ ERVSPWEIDP SVSLPPLSVQ  240
SSPRLKKLRT SLQAAPPNNA FTGRGGFMDF EDSVRSSKVL QGQENVGIVS PFYGCDTVKR  300
SLEFDVRSSA QQNQVSGGVE KLNIADYVKV HANSSFTGFM ESDRFLKVLQ GQEICSLRPP  360
TSKPEYSLGV WGKFNLSDNS FNTFQSPNSN FYHMASNSAQ KMYFPRSEMH STGQAAMMLS  420
NDSNFPRESA LFNPSAVGAN VIRTKMERTS RSLDRESLHL ASAPPTLGSN MRNSKDEHVN  480
DNATGCKLFG FSLTTETATN VQSSGKRSCT KVHKQGSLVG RAIDLSRLNG YTDLISELER  540
LFSMEGLLKD PDKGWRVLYT DNENDVMVVG DYPWHDFCDA VSKIHIYTQE EVEKMTNGVI  600
SDDTQSCLDQ APLCMEASKS SSVGQPDSPP TAVRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A3e-902230124354Auxin response factor 1
4ldw_A3e-902230124354Auxin response factor 1
4ldw_B3e-902230124354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3234090.0KU323409.1 UNVERIFIED: Trichosanthes dioica clone TdARF_7 auxin response factor 4-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011657217.10.0PREDICTED: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A0A0KFX80.0A0A0A0KFX8_CUCSA; Auxin response factor
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Saito Y, et al.
    Isolation of cucumber CsARF cDNAs and expression of the corresponding mRNAs during gravity-regulated morphogenesis of cucumber seedlings.
    J. Exp. Bot., 2004. 55(401): p. 1315-23
    [PMID:15133054]
  2. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  3. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]